![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily) beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134 |
![]() | Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) ![]() |
![]() | Family d.101.1.0: automated matches [227218] (1 protein) not a true family |
![]() | Protein automated matches [226956] (5 species) not a true protein |
![]() | Domain d2br2s2: 2br2 S:192-275 [146202] Other proteins in same PDB: d2br2a1, d2br2b1, d2br2b2, d2br2c1, d2br2d1, d2br2d2, d2br2e1, d2br2f1, d2br2f2, d2br2g1, d2br2h1, d2br2h2, d2br2i1, d2br2j1, d2br2j2, d2br2k1, d2br2l1, d2br2l2, d2br2m1, d2br2n1, d2br2n2, d2br2o1, d2br2p1, d2br2p2, d2br2q1, d2br2r1, d2br2r2, d2br2s1, d2br2t1, d2br2t2, d2br2u1, d2br2v1, d2br2v2, d2br2w1, d2br2x1, d2br2x2 automated match to d2je6a2 complexed with cl |
PDB Entry: 2br2 (more details), 2.8 Å
SCOPe Domain Sequences for d2br2s2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2br2s2 d.101.1.0 (S:192-275) automated matches {Sulfolobus solfataricus [TaxId: 2287]} plnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdi dqaentarstavklleelkkhlgi
Timeline for d2br2s2:
![]() Domains from other chains: (mouse over for more information) d2br2a1, d2br2a2, d2br2b1, d2br2b2, d2br2c1, d2br2c2, d2br2d1, d2br2d2, d2br2e1, d2br2e2, d2br2f1, d2br2f2, d2br2g1, d2br2g2, d2br2h1, d2br2h2, d2br2i1, d2br2i2, d2br2j1, d2br2j2, d2br2k1, d2br2k2, d2br2l1, d2br2l2, d2br2m1, d2br2m2, d2br2n1, d2br2n2, d2br2o1, d2br2o2, d2br2p1, d2br2p2, d2br2q1, d2br2q2, d2br2r1, d2br2r2, d2br2t1, d2br2t2, d2br2u1, d2br2u2, d2br2v1, d2br2v2, d2br2w1, d2br2w2, d2br2x1, d2br2x2 |