Lineage for d2br2n2 (2br2 N:156-248)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 869404Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 869405Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (1 family) (S)
  5. 869406Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (10 proteins)
  6. 869407Protein Exosome complex exonuclease 1, ECX1 [160590] (2 species)
  7. 869415Species Sulfolobus solfataricus [TaxId:2287] [160591] (7 PDB entries)
    Uniprot Q9UXC2 156-241! Uniprot Q9UXC2 156-248
  8. 869425Domain d2br2n2: 2br2 N:156-248 [146192]
    Other proteins in same PDB: d2br2a1, d2br2a2, d2br2b1, d2br2c1, d2br2c2, d2br2d1, d2br2e1, d2br2e2, d2br2f1, d2br2g1, d2br2g2, d2br2h1, d2br2i1, d2br2i2, d2br2j1, d2br2k1, d2br2k2, d2br2l1, d2br2m1, d2br2m2, d2br2n1, d2br2o1, d2br2o2, d2br2p1, d2br2q1, d2br2q2, d2br2r1, d2br2s1, d2br2s2, d2br2t1, d2br2u1, d2br2u2, d2br2v1, d2br2w1, d2br2w2, d2br2x1
    automatically matched to 2BR2 B:156-248
    complexed with cl

Details for d2br2n2

PDB Entry: 2br2 (more details), 2.8 Å

PDB Description: rnase ph core of the archaeal exosome
PDB Compounds: (N:) exosome complex exonuclease 1

SCOP Domain Sequences for d2br2n2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2br2n2 d.101.1.1 (N:156-248) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]}
pmrdliagvavgkadgviildlnetedmwgeadmpiammpslnqvtlfqlngsmtpdefr
qafdlavkginiiynlerealkskyvefkeegv

SCOP Domain Coordinates for d2br2n2:

Click to download the PDB-style file with coordinates for d2br2n2.
(The format of our PDB-style files is described here.)

Timeline for d2br2n2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2br2n1
View in 3D
Domains from other chains:
(mouse over for more information)
d2br2a1, d2br2a2, d2br2b1, d2br2b2, d2br2c1, d2br2c2, d2br2d1, d2br2d2, d2br2e1, d2br2e2, d2br2f1, d2br2f2, d2br2g1, d2br2g2, d2br2h1, d2br2h2, d2br2i1, d2br2i2, d2br2j1, d2br2j2, d2br2k1, d2br2k2, d2br2l1, d2br2l2, d2br2m1, d2br2m2, d2br2o1, d2br2o2, d2br2p1, d2br2p2, d2br2q1, d2br2q2, d2br2r1, d2br2r2, d2br2s1, d2br2s2, d2br2t1, d2br2t2, d2br2u1, d2br2u2, d2br2v1, d2br2v2, d2br2w1, d2br2w2, d2br2x1, d2br2x2