Lineage for d2br2a1 (2br2 A:1-191)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 852984Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 852985Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 853223Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (10 proteins)
  6. 853283Protein Exosome complex exonuclease 2,ECX2 [159920] (2 species)
  7. 853291Species Sulfolobus solfataricus [TaxId:2287] [159922] (7 PDB entries)
    Uniprot Q9UXC0 1-191
  8. 853295Domain d2br2a1: 2br2 A:1-191 [146165]
    Other proteins in same PDB: d2br2a2, d2br2b1, d2br2b2, d2br2c2, d2br2d1, d2br2d2, d2br2e2, d2br2f1, d2br2f2, d2br2g2, d2br2h1, d2br2h2, d2br2i2, d2br2j1, d2br2j2, d2br2k2, d2br2l1, d2br2l2, d2br2m2, d2br2n1, d2br2n2, d2br2o2, d2br2p1, d2br2p2, d2br2q2, d2br2r1, d2br2r2, d2br2s2, d2br2t1, d2br2t2, d2br2u2, d2br2v1, d2br2v2, d2br2w2, d2br2x1, d2br2x2
    automatically matched to 2JE6 A:1-191
    complexed with cl

Details for d2br2a1

PDB Entry: 2br2 (more details), 2.8 Å

PDB Description: rnase ph core of the archaeal exosome
PDB Compounds: (A:) exosome complex exonuclease 2

SCOP Domain Sequences for d2br2a1:

Sequence, based on SEQRES records: (download)

>d2br2a1 d.14.1.4 (A:1-191) Exosome complex exonuclease 2,ECX2 {Sulfolobus solfataricus [TaxId: 2287]}
msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
svnknevvgkl

Sequence, based on observed residues (ATOM records): (download)

>d2br2a1 d.14.1.4 (A:1-191) Exosome complex exonuclease 2,ECX2 {Sulfolobus solfataricus [TaxId: 2287]}
msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgkl

SCOP Domain Coordinates for d2br2a1:

Click to download the PDB-style file with coordinates for d2br2a1.
(The format of our PDB-style files is described here.)

Timeline for d2br2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2br2a2
View in 3D
Domains from other chains:
(mouse over for more information)
d2br2b1, d2br2b2, d2br2c1, d2br2c2, d2br2d1, d2br2d2, d2br2e1, d2br2e2, d2br2f1, d2br2f2, d2br2g1, d2br2g2, d2br2h1, d2br2h2, d2br2i1, d2br2i2, d2br2j1, d2br2j2, d2br2k1, d2br2k2, d2br2l1, d2br2l2, d2br2m1, d2br2m2, d2br2n1, d2br2n2, d2br2o1, d2br2o2, d2br2p1, d2br2p2, d2br2q1, d2br2q2, d2br2r1, d2br2r2, d2br2s1, d2br2s2, d2br2t1, d2br2t2, d2br2u1, d2br2u2, d2br2v1, d2br2v2, d2br2w1, d2br2w2, d2br2x1, d2br2x2