SCOPe 2.07: Domain d2bo3a1: 2bo3 A:1-93

Lineage for d2bo3a1 (2bo3 A:1-93)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.292: HP0242-like [158751] (1 superfamily)
   multihelical; intertwined homodimer of four-helical subunits, forming catenated triangular ring-like structures; pseudo knot

4. Superfamily a.292.1: HP0242-like [158752] (1 family)
   automatically mapped to Pfam PF09442

5. Family a.292.1.1: HP0242-like [158753] (1 protein)
   Pfam PF09442; DUF2018

6. Protein Hypothetical protein HP0242 [158754] (1 species)

7. Species Helicobacter pylori [TaxId:210] [158755] (4 PDB entries)
   Uniprot O25025 1-93! Uniprot O25025 13-92

8. Domain d2bo3a1: 2bo3 A:1-93 [146162]

Details for d2bo3a1

PDB Entry: 2bo3, 2.27 Å

PDB Description: crystal structure of hp0242, a hypothetical protein from helicobacter pylori

PDB Compounds: (A:) hypothetical protein hp0242

SCOPe Domain Sequences for d2bo3a1:

Sequence, based on SEQRES records:

>d2bo3a1 a.292.1.1 (A:1-93) Hypothetical protein HP0242 {Helicobacter pylori [TaxId: 210]}
mrdyseleifegnpldkwndiifhaskklskkelerllellalletfiekedleekfesf
akalrideelqqkiesrktdiviqsmanilsgn

Sequence, based on observed residues (ATOM records):

>d2bo3a1 a.292.1.1 (A:1-93) Hypothetical protein HP0242 {Helicobacter pylori [TaxId: 210]}
mrdyseeifegnpldkwndiifhaskklskkelerllellalletfiekedleekfesfa
kalrideelqqkiesrktdiviqsmanilsgn

Timeline for d2bo3a1:

• d2bo3a1 first appeared in SCOP 1.75
  
• d2bo3a1 appears in SCOPe 2.06
  
• d2bo3a1 appears in the current release, SCOPe 2.08