Lineage for d2bo1a1 (2bo1 A:1-100)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865651Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 865875Superfamily d.79.3: L30e-like [55315] (3 families) (S)
  5. 865876Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)
  6. 865877Protein Eukaryotic ribosomal protein L30 (L30e) [55317] (2 species)
  7. 865878Species Archaeon Thermococcus celer [TaxId:2264] [89986] (8 PDB entries)
  8. 865879Domain d2bo1a1: 2bo1 A:1-100 [146161]
    complexed with so4; mutant

Details for d2bo1a1

PDB Entry: 2bo1 (more details), 1.7 Å

PDB Description: crystal structure of a hybrid ribosomal protein l30e with surface residues from t. celer, and core residues from yeast
PDB Compounds: (A:) 50s ribosomal protein l30e

SCOP Domain Sequences for d2bo1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bo1a1 d.79.3.1 (A:1-100) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]}
vdiafelrkvidsgkytlgyrktvqslkmggskliiiarntrpdrkedleyyarlsgtpv
yefegtnvelgtavgkphtvsvvsildagesrilalggke

SCOP Domain Coordinates for d2bo1a1:

Click to download the PDB-style file with coordinates for d2bo1a1.
(The format of our PDB-style files is described here.)

Timeline for d2bo1a1: