Lineage for d2bnub1 (2bnu B:2-113)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2354864Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 2354892Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (30 PDB entries)
  8. 2354895Domain d2bnub1: 2bnu B:2-113 [146159]
    Other proteins in same PDB: d2bnua1, d2bnua2, d2bnub2
    automated match to d2bnqe1

Details for d2bnub1

PDB Entry: 2bnu (more details), 1.4 Å

PDB Description: structural and kinetic basis for heightened immunogenicity of t cell vaccines
PDB Compounds: (B:) T-cell receptor beta chain c region

SCOPe Domain Sequences for d2bnub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bnub1 b.1.1.1 (B:2-113) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
gvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgevpn
gynvsrsttedfplrllsaapsqtsvyfcassyvgntgelffgegsrltvle

SCOPe Domain Coordinates for d2bnub1:

Click to download the PDB-style file with coordinates for d2bnub1.
(The format of our PDB-style files is described here.)

Timeline for d2bnub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bnub2