SCOP 1.75: Domain d2bnub1: 2bnu B:2-113

Lineage for d2bnub1 (2bnu B:2-113)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (30 PDB entries)

8. Domain d2bnub1: 2bnu B:2-113 [146159]
   Other proteins in same PDB: d2bnub2
   automatically matched to 2BNQ E:2-113

Details for d2bnub1

PDB Entry: 2bnu, 1.4 Å

PDB Description: structural and kinetic basis for heightened immunogenicity of t cell vaccines

PDB Compounds: (B:) T-cell receptor beta chain c region

SCOP Domain Sequences for d2bnub1:

Sequence; same for both SEQRES and ATOM records:

>d2bnub1 b.1.1.1 (B:2-113) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
gvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgevpn
gynvsrsttedfplrllsaapsqtsvyfcassyvgntgelffgegsrltvle

Timeline for d2bnub1:

• d2bnub1 is new in SCOP 1.75
  
• d2bnub1 appears in SCOPe 2.01
  
• d2bnub1 appears in the current release, SCOPe 2.08