| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
| Family d.17.4.8: Limonene-1,2-epoxide hydrolase-like [89854] (3 proteins) automatically mapped to Pfam PF07858 |
| Protein automated matches [190519] (2 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:83332] [187477] (1 PDB entry) |
| Domain d2bngc_: 2bng C: [146158] Other proteins in same PDB: d2bnga1 automated match to d2bnga1 complexed with ca |
PDB Entry: 2bng (more details), 2.5 Å
SCOPe Domain Sequences for d2bngc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bngc_ d.17.4.8 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
etpetteairaveaflnalqnedfdtvdaalgddlvyenvgfsrirggrrtatllrrmqg
rvgfevkihrigadgaavltertdaliigplrvqfwvcgvfevddgritlwrdyfdvydm
fkgllrglvalvvpslkatl
Timeline for d2bngc_: