SCOPe 2.06: Domain d2bngb_: 2bng B:

Lineage for d2bngb_ (2bng B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.8: Limonene-1,2-epoxide hydrolase-like [89854] (3 proteins)
   automatically mapped to Pfam PF07858

6. Protein automated matches [190519] (2 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [187477] (1 PDB entry)

8. Domain d2bngb_: 2bng B: [146157]
   Other proteins in same PDB: d2bnga1
   automated match to d2bnga1
   complexed with ca

Details for d2bngb_

PDB Entry: 2bng, 2.5 Å

PDB Description: structure of an m.tuberculosis leh-like epoxide hydrolase

PDB Compounds: (B:) mb2760

SCOPe Domain Sequences for d2bngb_:

Sequence; same for both SEQRES and ATOM records:

>d2bngb_ d.17.4.8 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
petteairaveaflnalqnedfdtvdaalgddlvyenvgfsrirggrrtatllrrmqgrv
gfevkihrigadgaavltertdaliigplrvqfwvcgvfevddgritlwrdyfdvydmfk
gllrglvalvvps

Timeline for d2bngb_:

• d2bngb_ first appeared in SCOP 1.75, called d2bngb1
  
• d2bngb_ appears in SCOPe 2.05
  
• d2bngb_ appears in SCOPe 2.07
  
• d2bngb_ appears in the current release, SCOPe 2.08