![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.8: Limonene-1,2-epoxide hydrolase-like [89854] (3 proteins) automatically mapped to Pfam PF07858 |
![]() | Protein Uncharacterized protein Mb2760 [159963] (1 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [159964] (1 PDB entry) Uniprot Q7TY00 13-144 |
![]() | Domain d2bnga1: 2bng A:13-144 [146156] Other proteins in same PDB: d2bngb_, d2bngc_ complexed with ca |
PDB Entry: 2bng (more details), 2.5 Å
SCOPe Domain Sequences for d2bnga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bnga1 d.17.4.8 (A:13-144) Uncharacterized protein Mb2760 {Mycobacterium tuberculosis [TaxId: 1773]} etteairaveaflnalqnedfdtvdaalgddlvyenvgfsrirggrrtatllrrmqgrvg fevkihrigadgaavltertdaliigplrvqfwvcgvfevddgritlwrdyfdvydmfkg llrglvalvvps
Timeline for d2bnga1: