Lineage for d2bl8c1 (2bl8 C:4-103)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 767485Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 767681Superfamily a.29.8: Bacteriocin immunity protein-like [109797] (2 families) (S)
  5. 767686Family a.29.8.2: EntA-Im [140475] (1 protein)
  6. 767687Protein Enterocine A immunity protein, EntA-Im [140476] (1 species)
  7. 767688Species Enterococcus faecium [TaxId:1352] [140477] (2 PDB entries)
    Uniprot Q47785 3-82
  8. 767690Domain d2bl8c1: 2bl8 C:4-103 [146155]
    automatically matched to 2BL8 A:4-103
    complexed with flc

Details for d2bl8c1

PDB Entry: 2bl8 (more details), 1.6 Å

PDB Description: 1.6 angstrom crystal structure of enta-im: a bacterial immunity protein conferring immunity to the antimicrobial activity of the pediocin-like bacteriocin, enterocin a
PDB Compounds: (C:) enterocine a immunity protein

SCOP Domain Sequences for d2bl8c1:

Sequence, based on SEQRES records: (download)

>d2bl8c1 a.29.8.2 (C:4-103) Enterocine A immunity protein, EntA-Im {Enterococcus faecium [TaxId: 1352]}
nakqivhelyndisiskdpkysdilevlqkvylklekqkyeldpsplinrlvnylyftay
tnkirfteyqeelirnlseigrtaginglyradygdksqf

Sequence, based on observed residues (ATOM records): (download)

>d2bl8c1 a.29.8.2 (C:4-103) Enterocine A immunity protein, EntA-Im {Enterococcus faecium [TaxId: 1352]}
nakqivhelyndisiskdpkysdilevlqkvylklekqkyeldpsplinrlvnylyftay
tnkirfteyqeelirnlslyradygdksqf

SCOP Domain Coordinates for d2bl8c1:

Click to download the PDB-style file with coordinates for d2bl8c1.
(The format of our PDB-style files is described here.)

Timeline for d2bl8c1: