![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
![]() | Protein Calmodulin [47516] (13 species) |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [47522] (13 PDB entries) |
![]() | Domain d2bkhb_: 2bkh B: [146152] automated match to d2bbma_ complexed with ca, gol |
PDB Entry: 2bkh (more details), 2.4 Å
SCOPe Domain Sequences for d2bkhb_:
Sequence, based on SEQRES records: (download)
>d2bkhb_ a.39.1.5 (B:) Calmodulin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt idfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdeevd emireadidgdgqvnyeefvtmmts
>d2bkhb_ a.39.1.5 (B:) Calmodulin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt idfpefltmmseeeireafrvfdkdgngfisaaelrhvmtnlgekltdeevdemireadi dgdgqvnyeefvtmmts
Timeline for d2bkhb_: