SCOP 1.75: Domain d2bi8a2: 2bi8 A:248-316

Lineage for d2bi8a2 (2bi8 A:248-316)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.7: UDP-galactopyranose mutase [69670] (1 protein)

6. Protein UDP-galactopyranose mutase [69671] (2 species)

7. Species Klebsiella pneumoniae [TaxId:573] [117845] (3 PDB entries)
   Uniprot Q48485

8. Domain d2bi8a2: 2bi8 A:248-316 [146151]
   Other proteins in same PDB: d2bi8a1
   automatically matched to 2BI7 A:248-316
   complexed with fad

Details for d2bi8a2

PDB Entry: 2bi8, 2.35 Å

PDB Description: udp-galactopyranose mutase from klebsiella pneumoniae with reduced fad

PDB Compounds: (A:) udp-galactopyranose mutase

SCOP Domain Sequences for d2bi8a2:

Sequence; same for both SEQRES and ATOM records:

>d2bi8a2 d.16.1.7 (A:248-316) UDP-galactopyranose mutase {Klebsiella pneumoniae [TaxId: 573]}
gyrtldfkkftyqgdyqgcavmnycsvdvpytritehkyfspweqhdgsvcykeysrace
endipyypi

Timeline for d2bi8a2:

• d2bi8a2 is new in SCOP 1.75
  
• d2bi8a2 appears in SCOPe 2.01
  
• d2bi8a2 appears in the current release, SCOPe 2.08