Lineage for d2bi8a1 (2bi8 A:2-247,A:317-384)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850289Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2850290Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) (S)
    this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains
  5. 2850400Family c.4.1.3: UDP-galactopyranose mutase, N-terminal domain [69427] (1 protein)
    domain structure is similar to that of D-aminoacid oxidase
  6. 2850401Protein UDP-galactopyranose mutase, N-terminal domain [69428] (2 species)
  7. 2850405Species Klebsiella pneumoniae [TaxId:573] [117446] (3 PDB entries)
    Uniprot Q48485
  8. 2850407Domain d2bi8a1: 2bi8 A:2-247,A:317-384 [146150]
    Other proteins in same PDB: d2bi8a2
    automated match to d2bi7a1
    complexed with fad

Details for d2bi8a1

PDB Entry: 2bi8 (more details), 2.35 Å

PDB Description: udp-galactopyranose mutase from klebsiella pneumoniae with reduced fad
PDB Compounds: (A:) udp-galactopyranose mutase

SCOPe Domain Sequences for d2bi8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bi8a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]}
kskkilivgagfsgavigrqlaekghqvhiidqrdhiggnsydardsetnvmvhvygphi
fhtdnetvwnyvnkhaemmpyvnrvkatvngqvfslpinlhtinqffsktcspdearali
aekgdstiadpqtfeeealrfigkelyeaffkgytikqwgmqpselpasilkrlpvrfny
ddnyfnhkfqgmpkcgytqmiksilnhenikvdlqrefiveerthydhvfysgpldafyg
yqygrlXrqmgemallekylslaenetnitfvgrlgtyryldmdvtiaealktaevylns
ltenqpmpvftvsvr

SCOPe Domain Coordinates for d2bi8a1:

Click to download the PDB-style file with coordinates for d2bi8a1.
(The format of our PDB-style files is described here.)

Timeline for d2bi8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bi8a2