| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.4: Nucleotide-binding domain [51970] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) ![]() this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains |
| Family c.4.1.3: UDP-galactopyranose mutase, N-terminal domain [69427] (1 protein) domain structure is similar to that of D-aminoacid oxidase |
| Protein UDP-galactopyranose mutase, N-terminal domain [69428] (2 species) |
| Species Klebsiella pneumoniae [TaxId:573] [117446] (3 PDB entries) Uniprot Q48485 |
| Domain d2bi7a1: 2bi7 A:2-247,A:317-384 [146148] Other proteins in same PDB: d2bi7a2 complexed with fad |
PDB Entry: 2bi7 (more details), 2 Å
SCOPe Domain Sequences for d2bi7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]}
kskkilivgagfsgavigrqlaekghqvhiidqrdhiggnsydardsetnvmvhvygphi
fhtdnetvwnyvnkhaemmpyvnrvkatvngqvfslpinlhtinqffsktcspdearali
aekgdstiadpqtfeeealrfigkelyeaffkgytikqwgmqpselpasilkrlpvrfny
ddnyfnhkfqgmpkcgytqmiksilnhenikvdlqrefiveerthydhvfysgpldafyg
yqygrlXrqmgemallekylslaenetnitfvgrlgtyryldmdvtiaealktaevylns
ltenqpmpvftvsvr
Timeline for d2bi7a1: