Lineage for d2bhme_ (2bhm E:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1895674Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1896198Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1896877Family d.17.4.26: VirB8-like [160029] (2 proteins)
    Pfam PF04335
  6. 1896878Protein Type IV secretion system protein VirB8 [160030] (2 species)
  7. 1896881Species Brucella melitensis [TaxId:29459] [160032] (3 PDB entries)
    Uniprot Q7CEG3 97-235
  8. 1896896Domain d2bhme_: 2bhm E: [146147]
    automated match to d2bhma1

Details for d2bhme_

PDB Entry: 2bhm (more details), 2.4 Å

PDB Description: crystal structure of virb8 from brucella suis
PDB Compounds: (E:) type IV secretion system protein virb8

SCOPe Domain Sequences for d2bhme_:

Sequence, based on SEQRES records: (download)

>d2bhme_ d.17.4.26 (E:) Type IV secretion system protein VirB8 {Brucella melitensis [TaxId: 29459]}
sydtvmdkywlsqyviaretydwytlqkdyetvgmlsspsegqsyasqfqgdkaldkqyg
snvrtsvtivsivpngkgigtvrfakttkrtnetgdgetthwiatigyqyvnpslmsesa
rltnplgfnvtsyrvdpem

Sequence, based on observed residues (ATOM records): (download)

>d2bhme_ d.17.4.26 (E:) Type IV secretion system protein VirB8 {Brucella melitensis [TaxId: 29459]}
sydtvmdkywlsqyviaretydwytlqkdyetvgmlsspsegqsyasqfqgdkaldkqyg
snvrtsvtivsivpngkgigtvrfakttkrtdgetthwiatigyqyvnpslmsesarltn
plgfnvtsyrvdpem

SCOPe Domain Coordinates for d2bhme_:

Click to download the PDB-style file with coordinates for d2bhme_.
(The format of our PDB-style files is described here.)

Timeline for d2bhme_: