SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2bhme_ (2bhm E:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2161468Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2161993Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2162681Family d.17.4.26: VirB8-like [160029] (2 protein domains)
    Pfam PF04335
  6. 2162682Protein Type IV secretion system protein VirB8 [160030] (2 species)
  7. 2162685Species Brucella melitensis [TaxId:29459] [160032] (3 PDB entries)
    Uniprot Q7CEG3 97-235
  8. 2162700Domain d2bhme_: 2bhm E: [146147]
    automated match to d2bhma1

Details for d2bhme_

PDB Entry: 2bhm (more details), 2.4 Å

PDB Description: crystal structure of virb8 from brucella suis
PDB Compounds: (E:) type IV secretion system protein virb8

SCOPe Domain Sequences for d2bhme_:

Sequence, based on SEQRES records: (download)

>d2bhme_ d.17.4.26 (E:) Type IV secretion system protein VirB8 {Brucella melitensis [TaxId: 29459]}
sydtvmdkywlsqyviaretydwytlqkdyetvgmlsspsegqsyasqfqgdkaldkqyg
snvrtsvtivsivpngkgigtvrfakttkrtnetgdgetthwiatigyqyvnpslmsesa
rltnplgfnvtsyrvdpem

Sequence, based on observed residues (ATOM records): (download)

>d2bhme_ d.17.4.26 (E:) Type IV secretion system protein VirB8 {Brucella melitensis [TaxId: 29459]}
sydtvmdkywlsqyviaretydwytlqkdyetvgmlsspsegqsyasqfqgdkaldkqyg
snvrtsvtivsivpngkgigtvrfakttkrtdgetthwiatigyqyvnpslmsesarltn
plgfnvtsyrvdpem

SCOPe Domain Coordinates for d2bhme_:

Click to download the PDB-style file with coordinates for d2bhme_.
(The format of our PDB-style files is described here.)

Timeline for d2bhme_: