Class b: All beta proteins [48724] (177 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins) |
Protein automated matches [190384] (19 species) not a true protein |
Species Foot-and-mouth disease virus [TaxId:12110] [187460] (1 PDB entry) |
Domain d2bhgb_: 2bhg B: [146142] Other proteins in same PDB: d2bhga1 automated match to d2j92a1 |
PDB Entry: 2bhg (more details), 1.9 Å
SCOPe Domain Sequences for d2bhgb_:
Sequence, based on SEQRES records: (download)
>d2bhgb_ b.47.1.4 (B:) automated matches {Foot-and-mouth disease virus [TaxId: 12110]} dlqkmvmgntkpvelnldgktvaiccatgvfgtaylvprhlfaekydkimldgramtdsd yrvfefeikvkgqdmlsdaalmvlhrgnkvrditkhfrdtarmkkgtpvvgvvnnadvgr lifsgealtykdivvsmdgdtmpglfaykaatragyaggavlakdgadtfivgthsaggn gvgycscvsrsmlqkmkah
>d2bhgb_ b.47.1.4 (B:) automated matches {Foot-and-mouth disease virus [TaxId: 12110]} dlqkmvmgntkpvelnldgktvaiccatgvfgtaylvprhlfaekydkimldgramtdsd yrvfefelsdaalmvlhrgnkvrditkhfrdtarmkkgtpvvgvvnnadvgrlifsgeal tykdivmpglfaykaatragyaggavlakdgadtfivgthsaggngvgycscvsrsmlqk mkah
Timeline for d2bhgb_: