SCOPe 2.06: Domain d2bhgb_: 2bhg B:

Lineage for d2bhgb_ (2bhg B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein automated matches [190384] (19 species)
   not a true protein

7. Species Foot-and-mouth disease virus [TaxId:12110] [187460] (1 PDB entry)

8. Domain d2bhgb_: 2bhg B: [146142]
   Other proteins in same PDB: d2bhga1
   automated match to d2j92a1

Details for d2bhgb_

PDB Entry: 2bhg, 1.9 Å

PDB Description: 3c protease from type a10(61) foot-and-mouth disease virus

PDB Compounds: (B:) foot-and-mouth disease virus 3c protease

SCOPe Domain Sequences for d2bhgb_:

Sequence, based on SEQRES records:

>d2bhgb_ b.47.1.4 (B:) automated matches {Foot-and-mouth disease virus [TaxId: 12110]}
dlqkmvmgntkpvelnldgktvaiccatgvfgtaylvprhlfaekydkimldgramtdsd
yrvfefeikvkgqdmlsdaalmvlhrgnkvrditkhfrdtarmkkgtpvvgvvnnadvgr
lifsgealtykdivvsmdgdtmpglfaykaatragyaggavlakdgadtfivgthsaggn
gvgycscvsrsmlqkmkah

Sequence, based on observed residues (ATOM records):

>d2bhgb_ b.47.1.4 (B:) automated matches {Foot-and-mouth disease virus [TaxId: 12110]}
dlqkmvmgntkpvelnldgktvaiccatgvfgtaylvprhlfaekydkimldgramtdsd
yrvfefelsdaalmvlhrgnkvrditkhfrdtarmkkgtpvvgvvnnadvgrlifsgeal
tykdivmpglfaykaatragyaggavlakdgadtfivgthsaggngvgycscvsrsmlqk
mkah

Timeline for d2bhgb_:

• d2bhgb_ first appeared in SCOP 1.75, called d2bhgb1
  
• d2bhgb_ appears in SCOPe 2.05
  
• d2bhgb_ appears in SCOPe 2.07
  
• d2bhgb_ appears in the current release, SCOPe 2.08