Lineage for d2bhgb1 (2bhg B:7-205)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 802045Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 802046Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 803590Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (3 proteins)
  6. 803595Protein 3C cysteine protease (picornain 3C) [50604] (4 species)
  7. 803596Species Foot-and-mouth disease virus FMDV [TaxId:12110] [159189] (2 PDB entries)
    Uniprot P49303 1657-1755! Uniprot P49303 1657-1857
  8. 803598Domain d2bhgb1: 2bhg B:7-205 [146142]
    automatically matched to 2BHG A:7-205
    mutant

Details for d2bhgb1

PDB Entry: 2bhg (more details), 1.9 Å

PDB Description: 3c protease from type a10(61) foot-and-mouth disease virus
PDB Compounds: (B:) foot-and-mouth disease virus 3c protease

SCOP Domain Sequences for d2bhgb1:

Sequence, based on SEQRES records: (download)

>d2bhgb1 b.47.1.4 (B:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]}
dlqkmvmgntkpvelnldgktvaiccatgvfgtaylvprhlfaekydkimldgramtdsd
yrvfefeikvkgqdmlsdaalmvlhrgnkvrditkhfrdtarmkkgtpvvgvvnnadvgr
lifsgealtykdivvsmdgdtmpglfaykaatragyaggavlakdgadtfivgthsaggn
gvgycscvsrsmlqkmkah

Sequence, based on observed residues (ATOM records): (download)

>d2bhgb1 b.47.1.4 (B:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]}
dlqkmvmgntkpvelnldgktvaiccatgvfgtaylvprhlfaekydkimldgramtdsd
yrvfefelsdaalmvlhrgnkvrditkhfrdtarmkkgtpvvgvvnnadvgrlifsgeal
tykdivmpglfaykaatragyaggavlakdgadtfivgthsaggngvgycscvsrsmlqk
mkah

SCOP Domain Coordinates for d2bhgb1:

Click to download the PDB-style file with coordinates for d2bhgb1.
(The format of our PDB-style files is described here.)

Timeline for d2bhgb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bhga1