Lineage for d2bhgb_ (2bhg B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2797303Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2797935Protein automated matches [190384] (21 species)
    not a true protein
  7. 2797965Species Foot-and-mouth disease virus [TaxId:12110] [187460] (1 PDB entry)
  8. 2797966Domain d2bhgb_: 2bhg B: [146142]
    Other proteins in same PDB: d2bhga1
    automated match to d2j92a1

Details for d2bhgb_

PDB Entry: 2bhg (more details), 1.9 Å

PDB Description: 3c protease from type a10(61) foot-and-mouth disease virus
PDB Compounds: (B:) foot-and-mouth disease virus 3c protease

SCOPe Domain Sequences for d2bhgb_:

Sequence, based on SEQRES records: (download)

>d2bhgb_ b.47.1.4 (B:) automated matches {Foot-and-mouth disease virus [TaxId: 12110]}
dlqkmvmgntkpvelnldgktvaiccatgvfgtaylvprhlfaekydkimldgramtdsd
yrvfefeikvkgqdmlsdaalmvlhrgnkvrditkhfrdtarmkkgtpvvgvvnnadvgr
lifsgealtykdivvsmdgdtmpglfaykaatragyaggavlakdgadtfivgthsaggn
gvgycscvsrsmlqkmkah

Sequence, based on observed residues (ATOM records): (download)

>d2bhgb_ b.47.1.4 (B:) automated matches {Foot-and-mouth disease virus [TaxId: 12110]}
dlqkmvmgntkpvelnldgktvaiccatgvfgtaylvprhlfaekydkimldgramtdsd
yrvfefelsdaalmvlhrgnkvrditkhfrdtarmkkgtpvvgvvnnadvgrlifsgeal
tykdivmpglfaykaatragyaggavlakdgadtfivgthsaggngvgycscvsrsmlqk
mkah

SCOPe Domain Coordinates for d2bhgb_:

Click to download the PDB-style file with coordinates for d2bhgb_.
(The format of our PDB-style files is described here.)

Timeline for d2bhgb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bhga1