Lineage for d2bhga1 (2bhg A:7-205)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2406861Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2406866Protein 3C cysteine protease (picornain 3C) [50604] (9 species)
  7. 2406867Species Foot-and-mouth disease virus [TaxId:12110] [159189] (2 PDB entries)
    Uniprot P49303 1657-1755! Uniprot P49303 1657-1857
  8. 2406868Domain d2bhga1: 2bhg A:7-205 [146141]
    Other proteins in same PDB: d2bhgb_

Details for d2bhga1

PDB Entry: 2bhg (more details), 1.9 Å

PDB Description: 3c protease from type a10(61) foot-and-mouth disease virus
PDB Compounds: (A:) foot-and-mouth disease virus 3c protease

SCOPe Domain Sequences for d2bhga1:

Sequence, based on SEQRES records: (download)

>d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus [TaxId: 12110]}
dlqkmvmgntkpvelnldgktvaiccatgvfgtaylvprhlfaekydkimldgramtdsd
yrvfefeikvkgqdmlsdaalmvlhrgnkvrditkhfrdtarmkkgtpvvgvvnnadvgr
lifsgealtykdivvsmdgdtmpglfaykaatragyaggavlakdgadtfivgthsaggn
gvgycscvsrsmlqkmkah

Sequence, based on observed residues (ATOM records): (download)

>d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus [TaxId: 12110]}
dlqkmvmgntkpvelnldgktvaiccatgvfgtaylvprhlfaekydkimldgramtdsd
yrvfefeikvkgqdmlsdaalmvlhrgnkvrditkhfrdtarmkkgtpvvgvvnnadvgr
lifsgealtykdivvtmpglfaykaatragyaggavlakdgadtfivgthsaggngvgyc
scvsrsmlqkmkah

SCOPe Domain Coordinates for d2bhga1:

Click to download the PDB-style file with coordinates for d2bhga1.
(The format of our PDB-style files is described here.)

Timeline for d2bhga1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bhgb_