SCOPe 2.08: Domain d2bhga1: 2bhg A:7-205

Lineage for d2bhga1 (2bhg A:7-205)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein 3C cysteine protease (picornain 3C) [50604] (9 species)

7. Species Foot-and-mouth disease virus [TaxId:12110] [159189] (2 PDB entries)
   Uniprot P49303 1657-1755! Uniprot P49303 1657-1857

8. Domain d2bhga1: 2bhg A:7-205 [146141]
   Other proteins in same PDB: d2bhgb_

Details for d2bhga1

PDB Entry: 2bhg, 1.9 Å

PDB Description: 3c protease from type a10(61) foot-and-mouth disease virus

PDB Compounds: (A:) foot-and-mouth disease virus 3c protease

SCOPe Domain Sequences for d2bhga1:

Sequence, based on SEQRES records:

>d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus [TaxId: 12110]}
dlqkmvmgntkpvelnldgktvaiccatgvfgtaylvprhlfaekydkimldgramtdsd
yrvfefeikvkgqdmlsdaalmvlhrgnkvrditkhfrdtarmkkgtpvvgvvnnadvgr
lifsgealtykdivvsmdgdtmpglfaykaatragyaggavlakdgadtfivgthsaggn
gvgycscvsrsmlqkmkah

Sequence, based on observed residues (ATOM records):

>d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus [TaxId: 12110]}
dlqkmvmgntkpvelnldgktvaiccatgvfgtaylvprhlfaekydkimldgramtdsd
yrvfefeikvkgqdmlsdaalmvlhrgnkvrditkhfrdtarmkkgtpvvgvvnnadvgr
lifsgealtykdivvtmpglfaykaatragyaggavlakdgadtfivgthsaggngvgyc
scvsrsmlqkmkah

Timeline for d2bhga1:

• d2bhga1 first appeared in SCOP 1.75
  
• d2bhga1 appears in SCOPe 2.07