Class b: All beta proteins [48724] (174 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) |
Family b.18.1.4: Ephrin receptor ligand binding domain [49800] (3 proteins) |
Protein Ephrin type-B receptor 4 [158957] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [158958] (2 PDB entries) Uniprot P54760 17-196 |
Domain d2bbaa1: 2bba A:17-196 [146133] automatically matched to 2HLE A:17-196 complexed with so4 |
PDB Entry: 2bba (more details), 1.65 Å
SCOPe Domain Sequences for d2bbaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bbaa1 b.18.1.4 (A:17-196) Ephrin type-B receptor 4 {Human (Homo sapiens) [TaxId: 9606]} eetllntkletadlkwvtfpqvdgqweelsgldeeqhsvrtyevcdvqrapgqahwlrtg wvprrgavhvyatlrftmleclslpragrscketftvfyyesdadtataltpawmenpyi kvdtvaaehltrkrpgaeatgkvnvktlrlgplskagfylafqdqgacmallslhlfykk
Timeline for d2bbaa1: