Lineage for d2bb0b1 (2bb0 B:3-73,B:374-415)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 811542Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 811543Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (11 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 811761Family b.92.1.10: Imidazolonepropionase-like [159347] (3 proteins)
  6. 811762Protein Imidazolonepropionase [159348] (2 species)
  7. 811768Species Bacillus subtilis [TaxId:1423] [159349] (2 PDB entries)
    Uniprot P42084 3-73,374-415
  8. 811770Domain d2bb0b1: 2bb0 B:3-73,B:374-415 [146131]
    Other proteins in same PDB: d2bb0a2, d2bb0b2
    automatically matched to 2BB0 A:3-73,A:374-415
    complexed with act, zn

Details for d2bb0b1

PDB Entry: 2bb0 (more details), 2 Å

PDB Description: structure of imidazolonepropionase from bacillus subtilis
PDB Compounds: (B:) Imidazolonepropionase

SCOP Domain Sequences for d2bb0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bb0b1 b.92.1.10 (B:3-73,B:374-415) Imidazolonepropionase {Bacillus subtilis [TaxId: 1423]}
kqidtilinigqlltmessgpragksmqdlhviedavvgiheqkivfagqkgaeagyead
eiidcsgrlvtXlkagrsadlviwqapnymyipyhygvnhvhqvmkngtivvnr

SCOP Domain Coordinates for d2bb0b1:

Click to download the PDB-style file with coordinates for d2bb0b1.
(The format of our PDB-style files is described here.)

Timeline for d2bb0b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bb0b2