SCOPe 2.01: Domain d2bb0a2: 2bb0 A:74-373

Lineage for d2bb0a2 (2bb0 A:74-373)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.17: Imidazolonepropionase-like [159400] (3 proteins)

6. Protein Imidazolonepropionase [159405] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [159406] (2 PDB entries)
   Uniprot P42084 74-373

8. Domain d2bb0a2: 2bb0 A:74-373 [146130]
   Other proteins in same PDB: d2bb0a1, d2bb0b1
   complexed with act, zn

Details for d2bb0a2

PDB Entry: 2bb0, 2 Å

PDB Description: structure of imidazolonepropionase from bacillus subtilis

PDB Compounds: (A:) Imidazolonepropionase

SCOPe Domain Sequences for d2bb0a2:

Sequence; same for both SEQRES and ATOM records:

>d2bb0a2 c.1.9.17 (A:74-373) Imidazolonepropionase {Bacillus subtilis [TaxId: 1423]}
pglvdphthlvfggsrekemnlklqgisyldilaqgggilstvkdtraaseeellqkahf
hlqrmlsygtttaevksgygleketelkqlrvakklhesqpvdlvstfmgahaippeyqn
dpddfldqmlsllpeikeqelasfadiftetgvftvsqsrrylqkaaeagfglkihadei
dplggaelagklkavsadhlvgtsdegikklaeagtiavllpgttfylgkstyararami
degvcvslatdfnpgsspteniqlimsiaalhlkmtaeeiwhavtvnaayaigkgeeagq

Timeline for d2bb0a2:

• d2bb0a2 first appeared in SCOP 1.75
  
• d2bb0a2 appears in SCOPe 2.02
  
• d2bb0a2 appears in the current release, SCOPe 2.08