Lineage for d2bb0a1 (2bb0 A:3-73,A:374-415)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1140270Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 1140271Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (11 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 1140489Family b.92.1.10: Imidazolonepropionase-like [159347] (3 proteins)
  6. 1140490Protein Imidazolonepropionase [159348] (2 species)
  7. 1140496Species Bacillus subtilis [TaxId:1423] [159349] (2 PDB entries)
    Uniprot P42084 3-73,374-415
  8. 1140499Domain d2bb0a1: 2bb0 A:3-73,A:374-415 [146129]
    Other proteins in same PDB: d2bb0a2, d2bb0b2
    complexed with act, zn

Details for d2bb0a1

PDB Entry: 2bb0 (more details), 2 Å

PDB Description: structure of imidazolonepropionase from bacillus subtilis
PDB Compounds: (A:) Imidazolonepropionase

SCOPe Domain Sequences for d2bb0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bb0a1 b.92.1.10 (A:3-73,A:374-415) Imidazolonepropionase {Bacillus subtilis [TaxId: 1423]}
kqidtilinigqlltmessgpragksmqdlhviedavvgiheqkivfagqkgaeagyead
eiidcsgrlvtXlkagrsadlviwqapnymyipyhygvnhvhqvmkngtivvnr

SCOPe Domain Coordinates for d2bb0a1:

Click to download the PDB-style file with coordinates for d2bb0a1.
(The format of our PDB-style files is described here.)

Timeline for d2bb0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bb0a2