SCOPe 2.01: Domain d2ba1h2: 2ba1 H:179-257

Lineage for d2ba1h2 (2ba1 H:179-257)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134

4. Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (1 family)

5. Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (10 proteins)

6. Protein Exosome complex exonuclease 2, ECX2 [160597] (2 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [160598] (2 PDB entries)
   Uniprot O29756 179-257

8. Domain d2ba1h2: 2ba1 H:179-257 [146126]
   Other proteins in same PDB: d2ba1d1, d2ba1d2, d2ba1e1, d2ba1e2, d2ba1f1, d2ba1f2, d2ba1g1, d2ba1h1, d2ba1i1
   automatically matched to 2BA0 G:179-257
   complexed with zn

Details for d2ba1h2

PDB Entry: 2ba1, 2.7 Å

PDB Description: archaeal exosome core

PDB Compounds: (H:) Archaeal exosome complex exonuclease RRP42

SCOPe Domain Sequences for d2ba1h2:

Sequence; same for both SEQRES and ATOM records:

>d2ba1h2 d.101.1.1 (H:179-257) Exosome complex exonuclease 2, ECX2 {Archaeoglobus fulgidus [TaxId: 2234]}
pvrdlpvsvtslivgnkylvdpsreemsvgdttltittdkddnvvamqksggylldeklf
delldvsincarklrekfk

Timeline for d2ba1h2:

• d2ba1h2 first appeared in SCOP 1.75
  
• d2ba1h2 appears in SCOPe 2.02
  
• d2ba1h2 appears in the current release, SCOPe 2.08