![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 proteins) |
![]() | Protein Exosome complex exonuclease 2,ECX2 [159920] (2 species) |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [159921] (4 PDB entries) Uniprot O29756 3-178 |
![]() | Domain d2ba1h1: 2ba1 H:1-178 [146125] Other proteins in same PDB: d2ba1d1, d2ba1d2, d2ba1e1, d2ba1e2, d2ba1f1, d2ba1f2, d2ba1g2, d2ba1h2, d2ba1i2 automated match to d2ba0g1 complexed with zn |
PDB Entry: 2ba1 (more details), 2.7 Å
SCOPe Domain Sequences for d2ba1h1:
Sequence, based on SEQRES records: (download)
>d2ba1h1 d.14.1.4 (H:1-178) Exosome complex exonuclease 2,ECX2 {Archaeoglobus fulgidus [TaxId: 2234]} mpedilvdikrdyvlsklrdneridgrgfdefrkveiipnviekaegsalvklgdtqvvv gvkmqpgepypdtpdrgviivnaelvplasptfepgppdensielarvvdrgireseavd lsklvieegekvwivfvdihaldddgnlldasalaaiaalmntkvpaerfdlgedyll
>d2ba1h1 d.14.1.4 (H:1-178) Exosome complex exonuclease 2,ECX2 {Archaeoglobus fulgidus [TaxId: 2234]} mpedilvdikrdyvlsklrdneridgrgfdefrkveiipnviekaegsalvklgdtqvvv gvkmqpgepypdtpdrgviivnaelvpdensielarvvdrgireseavdlsklvieegek vwivfvdihaldddgnlldasalaaiaalmntkvpaerfdlgedyll
Timeline for d2ba1h1: