Lineage for d2ba1f2 (2ba1 F:154-252)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 869404Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 869405Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (1 family) (S)
  5. 869406Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (10 proteins)
  6. 869407Protein Exosome complex exonuclease 1, ECX1 [160590] (2 species)
  7. 869408Species Archaeoglobus fulgidus [TaxId:2234] [160592] (2 PDB entries)
    Uniprot O29757 154-252
  8. 869414Domain d2ba1f2: 2ba1 F:154-252 [146122]
    Other proteins in same PDB: d2ba1d1, d2ba1e1, d2ba1f1, d2ba1g1, d2ba1g2, d2ba1h1, d2ba1h2, d2ba1i1, d2ba1i2
    automatically matched to 2BA0 D:154-252
    complexed with zn

Details for d2ba1f2

PDB Entry: 2ba1 (more details), 2.7 Å

PDB Description: archaeal exosome core
PDB Compounds: (F:) Archaeal exosome complex exonuclease RRP41

SCOP Domain Sequences for d2ba1f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ba1f2 d.101.1.1 (F:154-252) Exosome complex exonuclease 1, ECX1 {Archaeoglobus fulgidus [TaxId: 2234]}
pmkgmitsvavgkadgqlvldpmkeednfgeadmpfaflirngkiesiallqmdgrmtrd
evkqaielakkgalqiyemqreailrryievgeemdeit

SCOP Domain Coordinates for d2ba1f2:

Click to download the PDB-style file with coordinates for d2ba1f2.
(The format of our PDB-style files is described here.)

Timeline for d2ba1f2: