Lineage for d2ba0i1 (2ba0 I:3-178)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 852984Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 852985Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 853223Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (10 proteins)
  6. 853283Protein Exosome complex exonuclease 2,ECX2 [159920] (2 species)
  7. 853284Species Archaeoglobus fulgidus [TaxId:2234] [159921] (2 PDB entries)
    Uniprot O29756 3-178
  8. 853287Domain d2ba0i1: 2ba0 I:3-178 [146115]
    Other proteins in same PDB: d2ba0a1, d2ba0a2, d2ba0a3, d2ba0b1, d2ba0b2, d2ba0b3, d2ba0c1, d2ba0c2, d2ba0c3, d2ba0d1, d2ba0d2, d2ba0e1, d2ba0e2, d2ba0f1, d2ba0f2, d2ba0g2, d2ba0h2, d2ba0i2
    automatically matched to 2BA0 G:3-178

Details for d2ba0i1

PDB Entry: 2ba0 (more details), 2.7 Å

PDB Description: archaeal exosome core
PDB Compounds: (I:) Archeal exosome RNA binding protein RRP42

SCOP Domain Sequences for d2ba0i1:

Sequence, based on SEQRES records: (download)

>d2ba0i1 d.14.1.4 (I:3-178) Exosome complex exonuclease 2,ECX2 {Archaeoglobus fulgidus [TaxId: 2234]}
edilvdikrdyvlsklrdneridgrgfdefrkveiipnviekaegsalvklgdtqvvvgv
kmqpgepypdtpdrgviivnaelvplasptfepgppdensielarvvdrgireseavdls
klvieegekvwivfvdihaldddgnlldasalaaiaalmntkvpaerfdlgedyll

Sequence, based on observed residues (ATOM records): (download)

>d2ba0i1 d.14.1.4 (I:3-178) Exosome complex exonuclease 2,ECX2 {Archaeoglobus fulgidus [TaxId: 2234]}
edilvdikrdyvlsklrdneridgrgfdefrkveiipnviekaegsalvklgdtqvvvgv
kmqpgepypdtpdrgviivnaelvplasptfeppdensielarvvdrgireseavdlskl
vieegekvwivfvdihaldddgnlldasalaaiaalmntkvpaerfdlgedyll

SCOP Domain Coordinates for d2ba0i1:

Click to download the PDB-style file with coordinates for d2ba0i1.
(The format of our PDB-style files is described here.)

Timeline for d2ba0i1: