Lineage for d2ba0h2 (2ba0 H:179-258)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967341Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 2967342Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) (S)
  5. 2967343Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (11 proteins)
  6. 2967405Protein Exosome complex exonuclease 2, ECX2 [160597] (2 species)
  7. 2967406Species Archaeoglobus fulgidus [TaxId:2234] [160598] (4 PDB entries)
    Uniprot O29756 179-257
  8. 2967414Domain d2ba0h2: 2ba0 H:179-258 [146114]
    Other proteins in same PDB: d2ba0a1, d2ba0a2, d2ba0a3, d2ba0b1, d2ba0b2, d2ba0b3, d2ba0c1, d2ba0c2, d2ba0c3, d2ba0d1, d2ba0d2, d2ba0e1, d2ba0e2, d2ba0f1, d2ba0f2, d2ba0g1, d2ba0h1, d2ba0i1
    automated match to d2ba0g2

Details for d2ba0h2

PDB Entry: 2ba0 (more details), 2.7 Å

PDB Description: archaeal exosome core
PDB Compounds: (H:) Archaeal exosome RNA binding protein RRP42

SCOPe Domain Sequences for d2ba0h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ba0h2 d.101.1.1 (H:179-258) Exosome complex exonuclease 2, ECX2 {Archaeoglobus fulgidus [TaxId: 2234]}
pvrdlpvsvtslivgnkylvdpsreemsvgdttltittdkddnvvamqksggylldeklf
delldvsincarklrekfke

SCOPe Domain Coordinates for d2ba0h2:

Click to download the PDB-style file with coordinates for d2ba0h2.
(The format of our PDB-style files is described here.)

Timeline for d2ba0h2: