Lineage for d2ba0h1 (2ba0 H:3-178)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930318Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 proteins)
  6. 2930380Protein Exosome complex exonuclease 2,ECX2 [159920] (2 species)
  7. 2930381Species Archaeoglobus fulgidus [TaxId:2234] [159921] (4 PDB entries)
    Uniprot O29756 3-178
  8. 2930389Domain d2ba0h1: 2ba0 H:3-178 [146113]
    Other proteins in same PDB: d2ba0a1, d2ba0a2, d2ba0a3, d2ba0b1, d2ba0b2, d2ba0b3, d2ba0c1, d2ba0c2, d2ba0c3, d2ba0d1, d2ba0d2, d2ba0e1, d2ba0e2, d2ba0f1, d2ba0f2, d2ba0g2, d2ba0h2, d2ba0i2
    automated match to d2ba0g1

Details for d2ba0h1

PDB Entry: 2ba0 (more details), 2.7 Å

PDB Description: archaeal exosome core
PDB Compounds: (H:) Archaeal exosome RNA binding protein RRP42

SCOPe Domain Sequences for d2ba0h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ba0h1 d.14.1.4 (H:3-178) Exosome complex exonuclease 2,ECX2 {Archaeoglobus fulgidus [TaxId: 2234]}
edilvdikrdyvlsklrdneridgrgfdefrkveiipnviekaegsalvklgdtqvvvgv
kmqpgepypdtpdrgviivnaelvplasptfepgppdensielarvvdrgireseavdls
klvieegekvwivfvdihaldddgnlldasalaaiaalmntkvpaerfdlgedyll

SCOPe Domain Coordinates for d2ba0h1:

Click to download the PDB-style file with coordinates for d2ba0h1.
(The format of our PDB-style files is described here.)

Timeline for d2ba0h1: