Lineage for d2ba0e2 (2ba0 E:154-252)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1663434Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 1663435Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) (S)
  5. 1663436Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (11 proteins)
  6. 1663437Protein Exosome complex exonuclease 1, ECX1 [160590] (2 species)
  7. 1663438Species Archaeoglobus fulgidus [TaxId:2234] [160592] (2 PDB entries)
    Uniprot O29757 154-252
  8. 1663440Domain d2ba0e2: 2ba0 E:154-252 [146108]
    Other proteins in same PDB: d2ba0a1, d2ba0a2, d2ba0a3, d2ba0b1, d2ba0b2, d2ba0b3, d2ba0c1, d2ba0c2, d2ba0c3, d2ba0d1, d2ba0e1, d2ba0f1, d2ba0g1, d2ba0g2, d2ba0h1, d2ba0h2, d2ba0i1, d2ba0i2
    automated match to d2ba0d2

Details for d2ba0e2

PDB Entry: 2ba0 (more details), 2.7 Å

PDB Description: archaeal exosome core
PDB Compounds: (E:) Archeal exosome RNA binding protein RRP41

SCOPe Domain Sequences for d2ba0e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ba0e2 d.101.1.1 (E:154-252) Exosome complex exonuclease 1, ECX1 {Archaeoglobus fulgidus [TaxId: 2234]}
pmkgmitsvavgkadgqlvldpmkeednfgeadmpfaflirngkiesiallqmdgrmtrd
evkqaielakkgalqiyemqreailrryievgeemdeit

SCOPe Domain Coordinates for d2ba0e2:

Click to download the PDB-style file with coordinates for d2ba0e2.
(The format of our PDB-style files is described here.)

Timeline for d2ba0e2: