Lineage for d2ba0c3 (2ba0 C:136-219)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1025556Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 1025557Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 1025558Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (16 proteins)
    an RNA-binding domain
  6. 1025559Protein Exosome complex RNA-binding protein 1, ECR1 [160229] (3 species)
  7. 1025562Species Archaeoglobus fulgidus [TaxId:2234] [160230] (1 PDB entry)
    Uniprot O29758 136-219
  8. 1025565Domain d2ba0c3: 2ba0 C:136-219 [146104]
    Other proteins in same PDB: d2ba0a1, d2ba0a2, d2ba0b1, d2ba0b2, d2ba0c1, d2ba0c2, d2ba0d1, d2ba0d2, d2ba0e1, d2ba0e2, d2ba0f1, d2ba0f2, d2ba0g1, d2ba0g2, d2ba0h1, d2ba0h2, d2ba0i1, d2ba0i2
    automatically matched to 2BA0 A:136-219

Details for d2ba0c3

PDB Entry: 2ba0 (more details), 2.7 Å

PDB Description: archaeal exosome core
PDB Compounds: (C:) Archeal exosome RNA binding protein RRP4

SCOPe Domain Sequences for d2ba0c3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ba0c3 d.51.1.1 (C:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]}
fgrivainparvprvigkkgsmikllkseldvqivvgqngliwvngdrrkvsiaeeaiyl
ieqeahtegltdrvaefikrrkad

SCOPe Domain Coordinates for d2ba0c3:

Click to download the PDB-style file with coordinates for d2ba0c3.
(The format of our PDB-style files is described here.)

Timeline for d2ba0c3: