Lineage for d2ba0c2 (2ba0 C:2-52)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 964158Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 964353Superfamily b.84.4: Ribosomal L27 protein-like [110324] (2 families) (S)
    rudiment single hybrid fold with a permuted topology
  5. 964404Family b.84.4.2: ECR1 N-terminal domain-like [159324] (4 proteins)
    ECR1 - Exosome complex RNA-binding protein 1
  6. 964405Protein Exosome complex RNA-binding protein 1, ECR1 [159329] (2 species)
  7. 964406Species Archaeoglobus fulgidus [TaxId:2234] [159330] (1 PDB entry)
    Uniprot O29758 2-52
  8. 964409Domain d2ba0c2: 2ba0 C:2-52 [146103]
    Other proteins in same PDB: d2ba0a1, d2ba0a3, d2ba0b1, d2ba0b3, d2ba0c1, d2ba0c3, d2ba0d1, d2ba0d2, d2ba0e1, d2ba0e2, d2ba0f1, d2ba0f2, d2ba0g1, d2ba0g2, d2ba0h1, d2ba0h2, d2ba0i1, d2ba0i2
    automatically matched to 2BA0 A:2-52

Details for d2ba0c2

PDB Entry: 2ba0 (more details), 2.7 Å

PDB Description: archaeal exosome core
PDB Compounds: (C:) Archeal exosome RNA binding protein RRP4

SCOPe Domain Sequences for d2ba0c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ba0c2 b.84.4.2 (C:2-52) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]}
rkivlpgdllstnpraagygtyveggkvyakiiglfdqtethvrviplkgr

SCOPe Domain Coordinates for d2ba0c2:

Click to download the PDB-style file with coordinates for d2ba0c2.
(The format of our PDB-style files is described here.)

Timeline for d2ba0c2: