Lineage for d2b9da1 (2b9d A:42-93)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 894715Fold g.91: E7 C-terminal domain-like [161233] (1 superfamily)
    alpha+beta zinc-binding domain; beta(2)-alpha(2)
  4. 894716Superfamily g.91.1: E7 C-terminal domain-like [161234] (1 family) (S)
  5. 894717Family g.91.1.1: E7 C-terminal domain-like [161235] (1 protein)
    C-terminal part of Pfam PF00527
  6. 894718Protein E7 oncoprotein [161236] (2 species)
  7. 894719Species Human papillomavirus type 1a [TaxId:10583] [161238] (1 PDB entry)
    Uniprot P06465 42-93
  8. 894720Domain d2b9da1: 2b9d A:42-93 [146094]
    complexed with zn

Details for d2b9da1

PDB Entry: 2b9d (more details), 1.6 Å

PDB Description: crystal structure of hpv e7 cr3 domain
PDB Compounds: (A:) E7 protein

SCOP Domain Sequences for d2b9da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9da1 g.91.1.1 (A:42-93) E7 oncoprotein {Human papillomavirus type 1a [TaxId: 10583]}
mkqpyavvascayceklvrltvladhsairqleemllrslnivcplctlqrq

SCOP Domain Coordinates for d2b9da1:

Click to download the PDB-style file with coordinates for d2b9da1.
(The format of our PDB-style files is described here.)

Timeline for d2b9da1: