Lineage for d2b9da1 (2b9d A:44-93)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038948Fold g.91: E7 C-terminal domain-like [161233] (1 superfamily)
    alpha+beta zinc-binding domain; beta(2)-alpha(2)
  4. 3038949Superfamily g.91.1: E7 C-terminal domain-like [161234] (1 family) (S)
    automatically mapped to Pfam PF00527
  5. 3038950Family g.91.1.1: E7 C-terminal domain-like [161235] (1 protein)
    C-terminal part of Pfam PF00527
  6. 3038951Protein E7 oncoprotein [161236] (2 species)
  7. 3038952Species Human papillomavirus type 1a [TaxId:10583] [161238] (1 PDB entry)
    Uniprot P06465 42-93
  8. 3038953Domain d2b9da1: 2b9d A:44-93 [146094]
    Other proteins in same PDB: d2b9da2, d2b9db3
    complexed with zn

Details for d2b9da1

PDB Entry: 2b9d (more details), 1.6 Å

PDB Description: crystal structure of hpv e7 cr3 domain
PDB Compounds: (A:) E7 protein

SCOPe Domain Sequences for d2b9da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9da1 g.91.1.1 (A:44-93) E7 oncoprotein {Human papillomavirus type 1a [TaxId: 10583]}
qpyavvascayceklvrltvladhsairqleemllrslnivcplctlqrq

SCOPe Domain Coordinates for d2b9da1:

Click to download the PDB-style file with coordinates for d2b9da1.
(The format of our PDB-style files is described here.)

Timeline for d2b9da1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2b9da2