Lineage for d2b95b_ (2b95 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2971065Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families) (S)
    alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices
  5. 2971066Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
    Pfam PF03259
  6. 2971097Protein automated matches [190414] (3 species)
    not a true protein
  7. 2971107Species Human (Homo sapiens) [TaxId:9606] [187290] (12 PDB entries)
  8. 2971136Domain d2b95b_: 2b95 B: [146093]
    Other proteins in same PDB: d2b95a1
    automated match to d2b95a1

Details for d2b95b_

PDB Entry: 2b95 (more details)

PDB Description: solution nmr structure of protein dynein light chain 2a, cytoplasmic; northeast structural genomics consortium target hr2106
PDB Compounds: (B:) Dynein light chain 2A

SCOPe Domain Sequences for d2b95b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b95b_ d.110.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfilkarstvrdi
dpqndltflrirskkneimvapdkdyfliviqnpte

SCOPe Domain Coordinates for d2b95b_:

Click to download the PDB-style file with coordinates for d2b95b_.
(The format of our PDB-style files is described here.)

Timeline for d2b95b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2b95a1