| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families) ![]() alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices |
| Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins) Pfam PF03259 |
| Protein Dynein light chain 2A, cytoplasmic [118074] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [118075] (3 PDB entries) Uniprot Q9NP97 |
| Domain d2b95a1: 2b95 A:11-106 [146092] Other proteins in same PDB: d2b95b_ |
PDB Entry: 2b95 (more details)
SCOPe Domain Sequences for d2b95a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b95a1 d.110.7.1 (A:11-106) Dynein light chain 2A, cytoplasmic {Human (Homo sapiens) [TaxId: 9606]}
maeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfilkarstvrdi
dpqndltflrirskkneimvapdkdyfliviqnpte
Timeline for d2b95a1: