Lineage for d2b95a1 (2b95 A:11-106)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1922390Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1923069Superfamily d.110.7: Roadblock/LC7 domain [103196] (1 family) (S)
    alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices
  5. 1923070Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
    Pfam PF03259
  6. 1923071Protein Dynein light chain 2A, cytoplasmic [118074] (2 species)
  7. 1923072Species Human (Homo sapiens) [TaxId:9606] [118075] (2 PDB entries)
    Uniprot Q9NP97
  8. 1923075Domain d2b95a1: 2b95 A:11-106 [146092]
    Other proteins in same PDB: d2b95b_

Details for d2b95a1

PDB Entry: 2b95 (more details)

PDB Description: solution nmr structure of protein dynein light chain 2a, cytoplasmic; northeast structural genomics consortium target hr2106
PDB Compounds: (A:) Dynein light chain 2A

SCOPe Domain Sequences for d2b95a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b95a1 d.110.7.1 (A:11-106) Dynein light chain 2A, cytoplasmic {Human (Homo sapiens) [TaxId: 9606]}
maeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfilkarstvrdi
dpqndltflrirskkneimvapdkdyfliviqnpte

SCOPe Domain Coordinates for d2b95a1:

Click to download the PDB-style file with coordinates for d2b95a1.
(The format of our PDB-style files is described here.)

Timeline for d2b95a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2b95b_