SCOPe 2.08: Domain d2b95a1: 2b95 A:11-106

Lineage for d2b95a1 (2b95 A:11-106)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families)
   alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices

5. Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
   Pfam PF03259

6. Protein Dynein light chain 2A, cytoplasmic [118074] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [118075] (3 PDB entries)
   Uniprot Q9NP97

8. Domain d2b95a1: 2b95 A:11-106 [146092]
   Other proteins in same PDB: d2b95b_

Details for d2b95a1

PDB Entry: 2b95

PDB Description: solution nmr structure of protein dynein light chain 2a, cytoplasmic; northeast structural genomics consortium target hr2106

PDB Compounds: (A:) Dynein light chain 2A

SCOPe Domain Sequences for d2b95a1:

Sequence; same for both SEQRES and ATOM records:

>d2b95a1 d.110.7.1 (A:11-106) Dynein light chain 2A, cytoplasmic {Human (Homo sapiens) [TaxId: 9606]}
maeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfilkarstvrdi
dpqndltflrirskkneimvapdkdyfliviqnpte

Timeline for d2b95a1:

• d2b95a1 first appeared in SCOP 1.75
  
• d2b95a1 appears in SCOPe 2.07