Class a: All alpha proteins [46456] (286 folds) |
Fold a.159: Another 3-helical bundle [81602] (5 superfamilies) topologically similar to the DNA/RNA-binding bundles; distinct packing |
Superfamily a.159.2: FF domain [81698] (1 family) |
Family a.159.2.1: FF domain [81699] (4 proteins) |
Protein Pre-mRNA-processing protein PRP40 [158354] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [158355] (1 PDB entry) Uniprot P33203 134-189 |
Domain d2b7ea1: 2b7e A:4-59 [146091] 1st FF domain |
PDB Entry: 2b7e (more details)
SCOPe Domain Sequences for d2b7ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b7ea1 a.159.2.1 (A:4-59) Pre-mRNA-processing protein PRP40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} eaekefitmlkenqvdstwsfsriiselgtrdprywmvdddplwkkemfekylsnr
Timeline for d2b7ea1: