Lineage for d2b7ea1 (2b7e A:4-59)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1752340Fold a.159: Another 3-helical bundle [81602] (5 superfamilies)
    topologically similar to the DNA/RNA-binding bundles; distinct packing
  4. 1752357Superfamily a.159.2: FF domain [81698] (1 family) (S)
  5. 1752358Family a.159.2.1: FF domain [81699] (4 proteins)
  6. 1752363Protein Pre-mRNA-processing protein PRP40 [158354] (1 species)
  7. 1752364Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [158355] (1 PDB entry)
    Uniprot P33203 134-189
  8. 1752365Domain d2b7ea1: 2b7e A:4-59 [146091]
    1st FF domain

Details for d2b7ea1

PDB Entry: 2b7e (more details)

PDB Description: first ff domain of prp40 yeast protein
PDB Compounds: (A:) Pre-mRNA processing protein PRP40

SCOPe Domain Sequences for d2b7ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b7ea1 a.159.2.1 (A:4-59) Pre-mRNA-processing protein PRP40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eaekefitmlkenqvdstwsfsriiselgtrdprywmvdddplwkkemfekylsnr

SCOPe Domain Coordinates for d2b7ea1:

Click to download the PDB-style file with coordinates for d2b7ea1.
(The format of our PDB-style files is described here.)

Timeline for d2b7ea1: