Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.268: ParB/Sulfiredoxin [110848] (1 superfamily) beta*-alpha-beta(2)-alpha-beta-alpha; mixed beta sheet forms a partly open barrel: (n*=4, S*=8) |
Superfamily d.268.1: ParB/Sulfiredoxin [110849] (5 families) |
Family d.268.1.4: Sulfiredoxin-like [160095] (2 proteins) PfamB PB015736 |
Protein Sulfiredoxin [160096] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [160097] (6 PDB entries) Uniprot Q9BYN0 17-137! Uniprot Q9BYN0 28-137! Uniprot Q9BYN0 30-137 |
Domain d2b6fa_: 2b6f A: [146087] automated match to d2riix_ complexed with atp, mg |
PDB Entry: 2b6f (more details)
SCOPe Domain Sequences for d2b6fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b6fa_ d.268.1.4 (A:) Sulfiredoxin {Human (Homo sapiens) [TaxId: 9606]} gapegpgpsggaqggsihsgriaavhnvplsvlirplpsvldpakvqslvdtiredpdsv ppidvlwikgaqggdyfysfggchryaayqqlqretipaklvqstlsdlrvylgastpdl q
Timeline for d2b6fa_: