Lineage for d2b61a1 (2b61 A:2-358)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136028Family c.69.1.40: O-acetyltransferase [159756] (2 protein domains)
  6. 2136067Protein Homoserine O-acetyltransferase [159759] (2 species)
  7. 2136068Species Haemophilus influenzae [TaxId:727] [159761] (1 PDB entry)
    Uniprot P45131 2-358
  8. 2136069Domain d2b61a1: 2b61 A:2-358 [146086]

Details for d2b61a1

PDB Entry: 2b61 (more details), 1.65 Å

PDB Description: Crystal Structure of Homoserine Transacetylase
PDB Compounds: (A:) Homoserine O-acetyltransferase

SCOPe Domain Sequences for d2b61a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]}
svqnvvlfdtqpltlmlggklsyinvayqtygtlndeknnavlichaltgdaepyfddgr
dgwwqnfmgaglaldtdryffissnvlggckgttgpssinpqtgkpygsqfpnivvqdiv
kvqkallehlgishlkaiiggsfggmqanqwaidypdfmdnivnlcssiyfsaeaigfnh
vmrqavindpnfnggdyyegtppdqglsiarmlgmltyrtdlqlakafgratksdgsfwg
dyfqvesylsyqgkkflerfdansylhllraldmydpslgyenvkealsrikarytlvsv
ttdqlfkpidlykskqlleqsgvdlhfyefpsdyghdaflvdydqfekrirdglagn

SCOPe Domain Coordinates for d2b61a1:

Click to download the PDB-style file with coordinates for d2b61a1.
(The format of our PDB-style files is described here.)

Timeline for d2b61a1: