![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) ![]() |
![]() | Family g.41.8.7: Ribosomal protein L40e [161181] (1 protein) Pfam PF01020 |
![]() | Protein Ribosomal protein L40e [161182] (1 species) |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [161183] (1 PDB entry) Uniprot Q980V5 1-56 |
![]() | Domain d2ayja1: 2ayj A:1-56 [146083] complexed with zn |
PDB Entry: 2ayj (more details)
SCOP Domain Sequences for d2ayja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ayja1 g.41.8.7 (A:1-56) Ribosomal protein L40e {Sulfolobus solfataricus [TaxId: 2287]} mpltdpaklqivqqrvflkkvcrkcgalnpiratkcrrchstnlrlkkkelptkkg
Timeline for d2ayja1: