Lineage for d2ayja1 (2ayj A:1-56)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036997Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 3037227Family g.41.8.7: Ribosomal protein L40e [161181] (1 protein)
    Pfam PF01020
  6. 3037228Protein Ribosomal protein L40e [161182] (1 species)
  7. 3037229Species Sulfolobus solfataricus [TaxId:2287] [161183] (1 PDB entry)
    Uniprot Q980V5 1-56
  8. 3037230Domain d2ayja1: 2ayj A:1-56 [146083]
    complexed with zn

Details for d2ayja1

PDB Entry: 2ayj (more details)

PDB Description: solution structure of 50s ribosomal protein l40e from sulfolobus solfataricus
PDB Compounds: (A:) 50S ribosomal protein L40e

SCOPe Domain Sequences for d2ayja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ayja1 g.41.8.7 (A:1-56) Ribosomal protein L40e {Sulfolobus solfataricus [TaxId: 2287]}
mpltdpaklqivqqrvflkkvcrkcgalnpiratkcrrchstnlrlkkkelptkkg

SCOPe Domain Coordinates for d2ayja1:

Click to download the PDB-style file with coordinates for d2ayja1.
(The format of our PDB-style files is described here.)

Timeline for d2ayja1: