Class a: All alpha proteins [46456] (289 folds) |
Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
Family a.43.1.11: PutA pre-N-terminal region-like [158485] (2 proteins) in PutA it forms a separate ribbon-helix-helix domain connected to the N-terminal enzymatic domain by a flexible linker |
Protein Bifunctional protein putA [158486] (1 species) |
Species Escherichia coli [TaxId:562] [158487] (2 PDB entries) Uniprot P09546 3-45 |
Domain d2ay0e_: 2ay0 E: [146081] automated match to d2ay0a1 complexed with cl; mutant |
PDB Entry: 2ay0 (more details), 2.1 Å
SCOPe Domain Sequences for d2ay0e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ay0e_ a.43.1.11 (E:) Bifunctional protein putA {Escherichia coli [TaxId: 562]} gtttmgvmlddatreriksaatridrtphwlikqaifsyleqle
Timeline for d2ay0e_: