SCOPe 2.02: Domain d2axwb_: 2axw B:

Lineage for d2axwb_ (2axw B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (9 proteins)

6. Protein Invasin AfaD [158928] (1 species)

7. Species Escherichia coli [TaxId:562] [158929] (3 PDB entries)
   Uniprot Q47038 27-147

8. Domain d2axwb_: 2axw B: [146076]
   automated match to d2axwa1
   complexed with cl, gol

Details for d2axwb_

PDB Entry: 2axw, 1.05 Å

PDB Description: Structure of DraD invasin from uropathogenic Escherichia coli

PDB Compounds: (B:) DraD invasin

SCOPe Domain Sequences for d2axwb_:

Sequence; same for both SEQRES and ATOM records:

>d2axwb_ b.2.3.2 (B:) Invasin AfaD {Escherichia coli [TaxId: 562]}
aelhlesrggsgtqlrdgakvatgriicreahtgfhvwmnerqvdgraeryvvqskdgrh
elrvrtggdgwspvkgeggkgvsrpgqeeqvffdvmadgnqdiapgeyrfsvggacvvpq
eklaaalehhhhhh

Timeline for d2axwb_:

• d2axwb_ first appeared in SCOP 1.75, called d2axwb1
  
• d2axwb_ appears in SCOPe 2.01
  
• d2axwb_ appears in SCOPe 2.03
  
• d2axwb_ appears in the current release, SCOPe 2.08, called d2axwb2