Lineage for d2axwa1 (2axw A:1-121)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 789808Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 789904Superfamily b.2.3: Bacterial adhesins [49401] (6 families) (S)
  5. 789909Family b.2.3.2: Pilus subunits [49405] (8 proteins)
  6. 789916Protein Invasin AfaD [158928] (1 species)
  7. 789917Species Escherichia coli [TaxId:562] [158929] (3 PDB entries)
    Uniprot Q47038 27-147
  8. 789918Domain d2axwa1: 2axw A:1-121 [146075]
    complexed with cl, gol

Details for d2axwa1

PDB Entry: 2axw (more details), 1.05 Å

PDB Description: Structure of DraD invasin from uropathogenic Escherichia coli
PDB Compounds: (A:) DraD invasin

SCOP Domain Sequences for d2axwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axwa1 b.2.3.2 (A:1-121) Invasin AfaD {Escherichia coli [TaxId: 562]}
aelhlesrggsgtqlrdgakvatgriicreahtgfhvwmnerqvdgraeryvvqskdgrh
elrvrtggdgwspvkgeggkgvsrpgqeeqvffdvmadgnqdiapgeyrfsvggacvvpq
e

SCOP Domain Coordinates for d2axwa1:

Click to download the PDB-style file with coordinates for d2axwa1.
(The format of our PDB-style files is described here.)

Timeline for d2axwa1: