SCOP 1.75: Domain d2at0x1: 2at0 X:1-184

Lineage for d2at0x1 (2at0 X:1-184)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (9 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (21 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Nitrophorin 4 [50845] (1 species)

7. Species Rhodnius prolixus [TaxId:13249] [50846] (34 PDB entries)
   Uniprot Q94734 22-205

8. Domain d2at0x1: 2at0 X:1-184 [146069]
   automatically matched to 3C76 X:1-184
   complexed with hem, no, po4; mutant

Details for d2at0x1

PDB Entry: 2at0, 1 Å

PDB Description: 1.00 a crystal structure of l133v mutant of nitrophorin 4 from rhodnius prolixus complexed with nitric oxide at ph 5.6

PDB Compounds: (X:) Nitrophorin 4

SCOP Domain Sequences for d2at0x1:

Sequence; same for both SEQRES and ATOM records:

>d2at0x1 b.60.1.1 (X:1-184) Nitrophorin 4 {Rhodnius prolixus [TaxId: 13249]}
actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
tclhkgnkdlgdvyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
lltk

Timeline for d2at0x1:

• d2at0x1 is new in SCOP 1.75
  
• d2at0x1 is called d2at0x_ in SCOPe 2.01
  
• d2at0x1 appears in the current release, SCOPe 2.08, called d2at0x_